PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00218.1.g00030.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 459aa    MW: 50516.9 Da    PI: 8.8057
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00218.1.g00030.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.2e-5231301128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat+
  Zjn_sc00218.1.g00030.1.am.mk   3 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATT 82 
                                   79****************************.99**************95334445667*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                    gyWkatgkd+++ + +g + g++ktLvfy+grap ge+tdWvmheyrl
  Zjn_sc00218.1.g00030.1.am.mk  83 MGYWKATGKDRRIAC-DGGVYGVRKTLVFYRGRAPGGERTDWVMHEYRL 130
                                   ***************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-572166IPR003441NAC domain
PROSITE profilePS5100555.6423167IPR003441NAC domain
PfamPF023651.3E-284130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MTLPPGFRFH PTDDELVGYY LKRKVDNLKI ELEVIPVIDL YKSEPWELPE KSFLPKRDLE  60
WFFFCPRDRK YPNGSRTNRA TTMGYWKATG KDRRIACDGG VYGVRKTLVF YRGRAPGGER  120
TDWVMHEYRL CQDLVHGASN FIVRPSSTTG PFITFQGGYA LCRVIKRHEA GLLQGEPPAR  180
AKGASTAGGA RGGQMTKVPS NSSLVSSDQL STFASTNSGS PPLDMRRGMC TVVESCNNFQ  240
NSLAYGGDAC DMAGTCATNG LPPPLFAPSD TSSQMCAPPH DLFFIGDDLP AAESRLSAGR  300
EYFFGDETGS VSERELKWDD LPIPTATANT FPTTTATDML CRQASDGIDD LAAFFFSDEN  360
RLAVDDGEKG RTQRGGRNPE GAPLLATDRK NNERNRTVHS WNLTARGEER VGAVAVSSRR  420
RPRFRARRRC GSVASSVRSH FCSPGPGIVV CPRKVKVAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-48113013140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1418428RRRPRFRARRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658556.11e-134PREDICTED: NAC domain-containing protein 67-like
TrEMBLA0A096R9061e-134A0A096R906_MAIZE; Uncharacterized protein
STRINGGRMZM2G082709_P011e-133(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-76NAC domain containing protein 71